Anti-Cathelicidin / CLP Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to Cathelicidin / CLP.
Applications:WB, IHC, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human CAMP (NP_004336.3), Product form:Liquid, Molecular weight:19 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300, Sequence:IIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:1,000, IHC: 1:50-1:200, Target:Cathelicidin / CLP
+25° C.
Additional Information
| Product Code | |
|---|---|
| Origin | USA |
| BTN - HC | |
| Size | |
| KGS | |
| Shipping Conditions |





