Anti-DGAT2 Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to DGAT2.
Applications:WB, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Mouse, Rat, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2), Product form:Liquid, Molecular weight:44 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal, Sequence:IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:1,000, Target:DGAT2
+25° C.