Unlock special prices! Log in or register to reveal exclusive offers.

Anti-GFP Antibody [1F1]

The prices will be displayed on the checkout.

Mouse monoclonal (1F1) antibody to GFP.

Applications:WB, ICC/IF, IHC, Host:Mouse, Clonality:Monoclonal, Clone ID:1F1, Isotype:IgM, Conjugate:Unconjugated, Immunogen:Recombinant Aequoria coerulescens GFP protein, expressed in and purified from E. coli, Concentration:1 mg/ml, Product form:Liquid, Molecular weight:27 kDa, Formulation:Supplied in Phosphate Buffered Saline with 50% Glycerol and 5mM Sodium Azide, Sequence:MVSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYK, Purification:Immunogen affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:1,000, ICC/IF: 1:1,000, Target:GFP

+25° C.

FacebookTwitterLinkedin

Additional Information

Product Code

Origin

USA

BTN - HC

Size

KGS

Shipping Conditions

0
    Your Cart
    Your cart is emptyReturn to Shop

    Unlock special prices!
    Log in or register to reveal exclusive offers.