Anti-GFP Antibody – Identical to Abcam (ab290)
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to GFP.
Applications:WB, ELISA, ICC/IF, Flow Cytometry, IHC-Fr, IHC-P, IP, Electron Microscopy, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Species independent, Immunogen:Recombinant full-length protein corresponding to Green Fluorescent Protein (GFP) from Aequorea victoria, Specificity:This antibody is reactive against all variants of Aequorea victoria GFP such as S65T-GFP, RS-GFP, YFP, CFP, RFP, and EGFP, Product form:Liquid, Purity:Whole antiserum, Formulation:Supplied as an aliquot of serum with 0.05% Sodium Azide and 1.25% Sodium Chloride, Antigen species:Aequorea victoria, Sequence:MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C or -80?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:1,000-1:2,500, ICC: 1:200-1:1,000, Flow Cytometry: 1:100, IHC-P: 1:500-1:1,000, IHC-Fr: 1:500-1:2,000, Electron Microscopy: 1:1,000-1:4,000, Target:GFP
+25° C.
