Anti-PDLIM5 / ENH Antibody – Identical to Abcam (ab196559)
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to PDLIM5 / ENH.
Applications:WB, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Rat, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 317-596 of human PDLIM5 (NP_006448.4), Product form:Liquid, Molecular weight:68 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide, Sequence:ASSVASTRSMPESLDSPTSGRPGVTSLTTAAAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:2,000, Target:PDLIM5 / ENH
+25° C.
Additional Information
| Product Code | |
|---|---|
| Origin | USA |
| BTN - HC | |
| Size | |
| KGS | |
| Shipping Conditions |





