Unlock special prices! Log in or register to reveal exclusive offers.

Anti-Properdin / PFC Antibody – Identical to Abcam (ab186834)

The prices will be displayed on the checkout.

Rabbit polyclonal antibody to Properdin / PFC.

Applications:WB, IHC, ICC/IF, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Rat, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 190-469 of human CFP (NP_001138724.1), Product form:Liquid, Molecular weight:51 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal, Sequence:CPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:1,000-1:5,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, Target:Properdin / PFC

+25° C.


Additional Information

Product Code






Shipping Conditions

    Your Cart
    Your cart is emptyReturn to Shop

    Unlock special prices!
    Log in or register to reveal exclusive offers.