Unlock special prices! Log in or register to reveal exclusive offers.

NRG1 Human

The prices will be displayed on the checkout.

Heregulin-B2 Human Recombinant

Host:Product form:Sterile Filtered White lyophilized (freeze-dried) powder, Source:Escherichia Coli, Purity:Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE, Formulation:Lyophilized from a 0.2µm filtered solution in 20mM PB, pH 7.4, containing 150mM NaCl, Sequence:SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ, Storage:Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18?C. Upon reconstitution Heregulin should be stored at 4?C between 2-7 days and for future use below -18?C.Please prevent freeze-thaw cycles, Target:NRG1

+25° C.

FacebookTwitterLinkedin

Additional Information

Product Code

Origin

USA

BTN - HC

Size

KGS

Shipping Conditions

0
    Your Cart
    Your cart is emptyReturn to Shop

    Unlock special prices!
    Log in or register to reveal exclusive offers.