Unlock special prices! Log in or register to reveal exclusive offers.

Protein G

The prices will be displayed on the checkout.

Protein G Recombinant

Host:Product form:Sterile Filtered White lyophilized (freeze-dried) powder, Source:Escherichia Coli, Purity:>96% as determined by SDS-PAGE and RP-HPLC, Formulation:Lyophilized white powder containing no additives, Sequence:LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE, Storage:Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles, Target:Protein G

+25° C.

FacebookTwitterLinkedin

Additional Information

Product Code

Origin

USA

BTN - HC

Size

KGS

Shipping Conditions

0
    Your Cart
    Your cart is emptyReturn to Shop

    Unlock special prices!
    Log in or register to reveal exclusive offers.