Unlock special prices! Log in or register to reveal exclusive offers.

Trypsin Porcine

The prices will be displayed on the checkout.

Trypsin Porcine Recombinant

Host:Product form:Sterile Filtered clear liquid solution, Source:Pichia Pastoris, Formulation:The Porcine Trypsin (2.98mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH-3, Sequence:VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN, Storage:Recombinant Porcine Trypsin should be stored at 2-8?C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA), Target:Trypsin Porcine

+25° C.

FacebookTwitterLinkedin

Additional Information

Product Code

Origin

USA

BTN - HC

Size

KGS

Shipping Conditions

0
    Your Cart
    Your cart is emptyReturn to Shop

    Unlock special prices!
    Log in or register to reveal exclusive offers.