Anti-Angiopoietin 2 / ANG2 Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to PARP1.
Applications:WB, ICC/IF, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Rat, Immunogen:A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2), Product form:Liquid, Molecular weight:89 kDa / 113 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal, Sequence:PGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:1,000-1:5,000, ICC/IF: 1:50-1:200, Target:PARP1
+25° C.
Additional Information
| Product Code | |
|---|---|
| Origin | USA |
| BTN - HC | |
| Size | |
| KGS | |
| Shipping Conditions |
