Unlock special prices! Log in or register to reveal exclusive offers.

Anti-Lamin B1 Antibody

The prices will be displayed on the checkout.

Rabbit polyclonal antibody to Lamin B1.

Applications:WB, IHC, ICC/IF, IP, ChIP, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Rat, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 503-586 of human Lamin B1 (P20700), Product form:Liquid, Molecular weight:68 kDa / 45 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal, Sequence:AGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000, ChIP: 1:500-1:1,000, Target:Lamin B1

+25° C.


Additional Information

Product Code






Shipping Conditions

    Your Cart
    Your cart is emptyReturn to Shop

    Unlock special prices!
    Log in or register to reveal exclusive offers.