- Only products within the same temperature range (+2 to +8°C or -20°C) are allowed in the cart. Add products with different shipping conditions to your WISH LIST to purchase them later.
Anti-MATH1 / HATH1 Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to MATH1 / HATH1.
Applications:WB, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human ATOH1 (NP_005163.1), Product form:Liquid, Molecular weight:35 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide, Sequence:LQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:2,000, Target:MATH1 / HATH1
+25° C.